PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PK04573.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Cannabaceae; Cannabis
Family GRAS
Protein Properties Length: 546aa    MW: 61473.8 Da    PI: 6.3452
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PK04573.1genomeCCBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS387.51.6e-1181755303361
       GRAS   3 elLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfshltaNqaI 102
                ++L+ecA avs++++++a +l++ l +++s +g+p+qRl ay++e+L+arl rs+s +yk+l+++e +   sse l+++++++++ P+ +f+++ aN  I
  PK04573.1 175 RVLIECACAVSESETTRAMELMEVLGNMVSVSGEPIQRLGAYMLEGLRARLERSGSAIYKSLKCNEPT---SSELLSYMSILYQIVPFWRFAYISANVVI 271
                68*****************************************************************9...9**************************** PP

       GRAS 103 leavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvlvakrledleleeLrvkpgE 200
                 ea++ e r+HiiDf+i qG QW+aL++ La Rp+gpp +RiTgv++++s   +   l+ +++rL k A++l+vpfef+  +a   ++++le+Lr++pgE
  PK04573.1 272 REAIQYEPRIHIIDFQIAQGSQWMALFEDLARRPGGPPFVRITGVDDSQSAfaRGGGLSLVEKRLLKQAQSLNVPFEFHG-AAMCGSEVKLETLRIRPGE 370
                ***********************************************99989999*************************.899**************** PP

       GRAS 201 alaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerikvErellgreivnvvac 300
                a++Vn+ + lh++ desvs+e++rd++L+l+kslsPkv+++veqe+++n+++Fl rf e+l+yy+a+f+s+++  pr++++ri+ E+++++r+ivn+vac
  PK04573.1 371 AIVVNCPYVLHHMADESVSTENHRDRLLRLIKSLSPKVMTLVEQESNTNTSPFLGRFRETLDYYTAMFESIDVARPRDDKQRISAEQHCVARDIVNMVAC 470
                **************************************************************************************************** PP

       GRAS 301 egaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlg 361
                eg++r+erhe + kW +rl++aG++p+pls++++  +k llr+++ + +r e+++g+l+l 
  PK04573.1 471 EGQQRVERHELFTKWWSRLTMAGLSPYPLSSSVTYAVKDLLREFNPN-FRTEQRHGALFLA 530
                *********************************************55.**********985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098563.11147524IPR005202Transcription factor GRAS
PfamPF035145.4E-116175530IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010200Biological Processresponse to chitin
Sequence ? help Back to Top
Protein Sequence    Length: 546 aa     Download sequence    Send to blast
MQTSQKHQRV SVIHGLYHKP MQEIDSHCMP HFQILDTNMF SEVGSQGKSV SFETCNEKFF  60
TLDSSPATTE FLNCDSPSAV SVLSNRSPFS PQGSHTCSSD PHHSPDIHSG SSFSGCSGVD  120
DSSDLKHRLR EIEKMLGVES EIVDSHFCSF KAESRQAPSM ATWKMMENNK MDLPRVLIEC  180
ACAVSESETT RAMELMEVLG NMVSVSGEPI QRLGAYMLEG LRARLERSGS AIYKSLKCNE  240
PTSSELLSYM SILYQIVPFW RFAYISANVV IREAIQYEPR IHIIDFQIAQ GSQWMALFED  300
LARRPGGPPF VRITGVDDSQ SAFARGGGLS LVEKRLLKQA QSLNVPFEFH GAAMCGSEVK  360
LETLRIRPGE AIVVNCPYVL HHMADESVST ENHRDRLLRL IKSLSPKVMT LVEQESNTNT  420
SPFLGRFRET LDYYTAMFES IDVARPRDDK QRISAEQHCV ARDIVNMVAC EGQQRVERHE  480
LFTKWWSRLT MAGLSPYPLS SSVTYAVKDL LREFNPNFRT EQRHGALFLA GRTELWPPVL  540
HGDEEG
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A8e-441775198348GRAS family transcription factor containing p
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010094683.10.0hypothetical protein L484_004260
SwissprotQ9M0M50.0SCL13_ARATH; Scarecrow-like protein 13
TrEMBLW9QX670.0W9QX67_9R
STRINGPOPTR_0016s01110.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF43773360
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G17230.10.0SCARECROW-like 13